Return to main results Retrieve Phyre Job Id

Job DescriptionASR85474.1_RusA-like_resolvase_[Mycobacterium_phage_Cain]
Confidence11.54%DateMon Jun 7 16:50:03 BST 2021
Rank9Aligned Residues30
% Identity37%Templatec6u08H_
PDB info PDB header:toxinChain: H: PDB Molecule:dddi; PDBTitle: double-stranded dna-specific cytidine deaminase type vi secretion2 system effector and cognate immunity complex from burkholderia3 cenocepacia
Resolution2.49 Å
Model Dimensions (Å)X:20.001 Y:30.355 Z:25.618

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50......... 60.........70......
Predicted Secondary structure  .........






Query SS confidence 












. . . . . . . . .
















Query Sequence  ESYDVLYAALSAR. . . . . . . . . VTYERNGGRQLRMFVPG
Query Conservation               .........      
 
 

 



Alig confidence 












.........
















Template Conservation 
    
   
 

     
 




 
 




  
 
 
Template Sequence  DEVDSLVEFLSRRPAFDANNFVLTFEESGFPQLNIFAKN
Template Known Secondary structure 
STT


BTTSSTT

ST
Template Predicted Secondary structure 








Template SS confidence 






































   13......20.........30.........40.........50.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in JSmol

Send structure to FirstGlance for more viewing options


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D